Protein coding transcript 170023

• Transcript: Ll_transcript_262454
• CDS coordinates: 123-479 (+)
• Peptide sequence: MQNPLTQTMNNPFFKVAVVGSGISGAVCASTLARNGVYVTLFDSARGPGGRMSQRREKTEDGKELHFDHGAPFFSVSKSELLCLVQEWQSRGLVAEWKEKFGSFDFRTLKFDNIYQVH*
• ORF Type: complete

Annotations of Ll_transcript_262454

• Blastp: Renalase from Pseudomonas with 39.33% of identity
• Blastx: -
• Eggnog: fad dependent oxidoreductase(COG3380)
• Kegg: Link to kegg annotations (PSPTO_1126)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443763.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;