Protein coding transcript 170029

• Transcript: Ll_transcript_262704
• CDS coordinates: 2-433 (+)
• Peptide sequence: PFSMHQQQLAMLAQQQSLLIAAAAKSTVGGPKYTANLQQPSSNVPGQSWPPMGYPISGTMPMVGQGDMQKLMQTRNMTPGHPPASSVLYPPSGFYPMGQVAPVNGTITTGVIKPRSAPVSSTTLQSAKDYDFSSLTQGMFAKQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_262704

• Blastp: Probable ADP-ribosylation factor GTPase-activating protein AGD5 from Arabidopsis with 46.84% of identity
• Blastx: Probable ADP-ribosylation factor GTPase-activating protein AGD5 from Arabidopsis with 45.61% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT5G54310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443986.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;