Protein coding transcript 170069

• Transcript: Ll_transcript_124301
• CDS coordinates: 39-758 (+)
• Peptide sequence: MNAMDTHSFSFASSFFSPKRRLLLPFSAIAKPHKLPEEIRVCTNRTCRRQGSFQTLETLSSLSPPNLAVKPSGCLGRCGAGPNLVLLPDGIVVGHCGTTAQAAELMVRLFPGDFDVKDCLDALALKKSADFECEKGNFVEAEILLSQIIDLKRFGGIHVTFKCRSSVRLELGNCSGALQDANEALRLAPRYHEAYICQGDAFLALEQFDSAEQSYLAALDIDPLIRRSKSFKVALNLCP*
• ORF Type: complete

Annotations of Ll_transcript_124301

• Blastp: Hsp70-Hsp90 organizing protein 2 from Arabidopsis with 39.39% of identity
• Blastx: -
• Eggnog: tetratricopeptide repeat domain(ENOG410XTCJ)
• Kegg: Link to kegg annotations (AT1G62740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420333.1)
• Pfam: Tetratricopeptide repeat (PF13432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;