Transcript | Ll_transcript_124301 |
---|---|
CDS coordinates | 39-758 (+) |
Peptide sequence | MNAMDTHSFSFASSFFSPKRRLLLPFSAIAKPHKLPEEIRVCTNRTCRRQGSFQTLETLSSLSPPNLAVKPSGCLGRCGAGPNLVLLPDGIVVGHCGTTAQAAELMVRLFPGDFDVKDCLDALALKKSADFECEKGNFVEAEILLSQIIDLKRFGGIHVTFKCRSSVRLELGNCSGALQDANEALRLAPRYHEAYICQGDAFLALEQFDSAEQSYLAALDIDPLIRRSKSFKVALNLCP* |
ORF Type | complete |
Blastp | Hsp70-Hsp90 organizing protein 2 from Arabidopsis with 39.39% of identity |
---|---|
Blastx | - |
Eggnog | tetratricopeptide repeat domain(ENOG410XTCJ) |
Kegg | Link to kegg annotations (AT1G62740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420333.1) |
Pfam | Tetratricopeptide repeat (PF13432.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer