Protein coding transcript 170185

• Transcript: Ll_transcript_121881
• CDS coordinates: 2-706 (+)
• Peptide sequence: ASSLFQNPTFLQPPPPTSSAARRSYFPVRCGGPRSQRGPLVKGRVLSIEAIQAIQTLKRLHRTNPPDLSHALSPTLTRLLKSDLVAALRELIRQQNCALAMRVFSTLRTEYGADLTHHAEMAKALGNCGMLEELDNLIVELEEGGEIDCGDYKGLVNLIKAVIGAKRRESMVRVYGLMKKCGWGSVVVPDEYVVQVLVNGFKSFDEIELAKEVQDECNRAFANFSRAKLDKLKI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_121881

• Blastp: Pentatricopeptide repeat-containing protein At3g46870 from Arabidopsis with 31.25% of identity
• Blastx: -
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410YDVV)
• Kegg: Link to kegg annotations (AT3G46870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425701.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;