Protein coding transcript 17020

• Transcript: Ll_transcript_276949
• CDS coordinates: 3-773 (+)
• Peptide sequence: GLGWAGLHAHSRVHLTEKKERRREGMECAAKGSGTRCTGLATRPCARCGAVSYCSLSHQIAHWGQHKLECDRLEQQMESVHFINDFPFTFSREATLQVCVKQETRCSFLSKRGLHQVGMWMNECSCWASYDRFECSRLNSGWDLPSISCPCCGPESLLSEQLHSWRDYYKWRHIPLDSPVAVLLHWPLTIFHAAQLVGITALNPEVSDKLYIHYLGPEKELLQLAIFGELLALFPGVHIHIELVGPAIPPQRKQGW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_276949

• Blastp: Zinc finger MYND domain-containing protein 15 from Mus with 31.8% of identity
• Blastx: Zinc finger MYND domain-containing protein 15 from Mus with 31.8% of identity
• Eggnog: zinc finger, MYND-type containing 15(ENOG4111I8B)
• Kegg: Link to kegg annotations (574428)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445499.1)
• Pfam: MYND finger (PF01753.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;