Protein coding transcript 170207

• Transcript: Ll_transcript_123774
• CDS coordinates: 104-1021 (-)
• Peptide sequence: MPLQNILEIEIFDCWGIDFMGPFPPSFSNEYILVAVDYVSRWVEAQATPKADSQTVIKFLKQIFARFGTPRVLISDGGSHFINNSLKKTLEFYNVHHKVASPYHPQTNGQAEVSNRELKRILQKTVSSSRKDWSQKLNDTLWAYRTAFKSPIGKTPYQLVYGKACHLPVELEHKAYWALKFLNFDLKDAGKQRKNQLHQLEEMRFQAYESSKLYKEKTKKYHDAKITKKEFHPGQQVLLFNSRLQIFPGKFKTKWTGPFVVKTVTEYGAIEIEDPKSQTTWTVNGQRLKHYLCNATDFITQDESE*
• ORF Type: complete

Annotations of Ll_transcript_123774

• Blastp: Pol polyprotein from Murine leukemia virus with 27.74% of identity
• Blastx: Pro-Pol polyprotein from Spumavirus with 26.77% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001274)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014629745.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;