Protein coding transcript 170208

• Transcript: Ll_transcript_123790
• CDS coordinates: 104-1483 (-)
• Peptide sequence: VADHLSRLKKENVALKEKEIAETFPDENLFQLQERPWFADFANYKASGIIPEHFDSQQKNIFLKQVKDYIWDEPYLFKEGTDNIIRRCVDETEAKKILWHCHNSAYGGHYNGQRTATKVLQSGFFWPTIFRDAQIHVQKCDACQKFGGLGKKSAMPLQNILEIEIFDCWGIDFMGPFPPSFSNEYILVAVDYVSRWVEAQATPKADSQTVIKFLKQIFARFGTPRVLISDGGSHFINNSLKKTLEFYNVHHKVASPYHPQTNGQAEVSNRELKRILQKTVSSSRKDWSQKLNDTLWAYRTAFKSPIGKTPYQLVYGKACHLPVELEHKAYWALKFLNFDLKDAGKQRKNQLHQLEEMRFQAYESSKLYKEKTKKYHDAKITKKEFHPGQQVLLFNSRLQIFPGKFKTKWTGPFVVKTVTEYGAIEIEDPKSQTTWTVNGQRLKHYLCNATDFITQDESE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_123790

• Blastp: Pro-Pol polyprotein from Spumavirus with 24.03% of identity
• Blastx: Pro-Pol polyprotein from Spumavirus with 24.03% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (6386687)
• CantataDB: Link to cantataDB annotations (CNT0001274)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014621692.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;