Protein coding transcript 170266

• Transcript: Ll_transcript_122152
• CDS coordinates: 547-1026 (+)
• Peptide sequence: MLAEYTYSESPEVDMAKVTYHFVRGNNPKKFASALVNFMEKCYPGEDDLAVARAVLRYLSYGNLRDANKLMDEIRKQSDSTEVEFHQTELTQFIDYLLQTLVRDALPLFNMLRANFKSNIDREPAFNEMLDDIAEKFYGVQRRNPMGMFGDIFKMMGVE*
• ORF Type: complete

Annotations of Ll_transcript_122152

• Blastp: Golgi to ER traffic protein 4 homolog from Dictyostelium with 34.04% of identity
• Blastx: Golgi to ER traffic protein 4 homolog from Dictyostelium with 30.36% of identity
• Eggnog: golgi to ER traffic protein 4 homolog(ENOG410XRWE)
• Kegg: Link to kegg annotations (DDB_G0281815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432891.1)
• Pfam: Protein of unknown function (DUF410) (PF04190.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;