Transcript | Ll_transcript_122156 |
---|---|
CDS coordinates | 3-740 (+) |
Peptide sequence | LVLGIKITSKGNMSNERAKRATLPPAQQNIDKLEKVVSAGNYYGAQQMYKSITARYVSAQRFSEALDILQSGACTQLAHGQVTCGAELALLFVETLRKGKIPYDSETLGRLEKIYEAFPRVPLPQHLNHLGDDDDDIQQVSEALGAAKIRAEGCSSFLKAAIRWSAEFAANGYGSPELHIMLAEYTYSESPEVDMAKVTYHFVRGNNPKKFASALVNFMEKCYPGEDDLAVARAVLRRRFVNMTP* |
ORF Type | 5prime_partial |
Blastp | Golgi to ER traffic protein 4 homolog from Dictyostelium with 28.44% of identity |
---|---|
Blastx | Golgi to ER traffic protein 4 homolog from Dictyostelium with 28.08% of identity |
Eggnog | golgi to ER traffic protein 4 homolog(ENOG410XRWE) |
Kegg | Link to kegg annotations (DDB_G0281815) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432891.1) |
Pfam | Protein of unknown function (DUF410) (PF04190.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer