| Transcript | Ll_transcript_122178 |
|---|---|
| CDS coordinates | 194-694 (+) |
| Peptide sequence | MQSQIVCNGCRNILLYPRGATNVCCALCNTITAVPPPGMEMSQIYCGGCRTLLMYARGASSVRCSCCHTVNLVPASNQVSHIHCGNCRTTLMYPYGAPSVKCALCHYVTNASTTNGRLPIPSQRPDGTTNPGTSQSQTVVVENPMSVDSSGKLVSNVVVGVTTDKK* |
| ORF Type | complete |
| Blastp | Protein LSD1 from Arabidopsis with 67.39% of identity |
|---|---|
| Blastx | Protein LSD1 from Arabidopsis with 65.61% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT4G20380) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435339.1) |
| Pfam | LSD1 zinc finger (PF06943.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer