Protein coding transcript 170279

• Transcript: Ll_transcript_122170
• CDS coordinates: 228-581 (+)
• Peptide sequence: MQSQVVCNGCRNILLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYARGGTSVRCSCCHTVNLVPASNQVSHIHCGNCQTTLMYPYGAPSVKCALCHYITNVSVSIHL*
• ORF Type: complete

Annotations of Ll_transcript_122170

• Blastp: Protein LSD1 from Oryza sativa with 67.26% of identity
• Blastx: Protein LSD1 from Oryza sativa with 67.26% of identity
• Eggnog: LSD1 zinc finger domain containing protein, expressed(ENOG410YHD1)
• Kegg: Link to kegg annotations (4344713)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435338.1)
• Pfam: LSD1 zinc finger (PF06943.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;