Protein coding transcript 170280

• Transcript: Ll_transcript_122174
• CDS coordinates: 602-1132 (+)
• Peptide sequence: MQSQVVCNGCRNILLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYARGGTSVRCSCCHTVNLVPASNQVSHIHCGNCQTTLMYPYGAPSVKCALCHYITNVSTTNGRLPIPGQRPNGTTNQGTVSSTPTSMPHSQSQTVVVENPMSVDSSGKLVSNVVVGVTTEKR*
• ORF Type: complete

Annotations of Ll_transcript_122174

• Blastp: Protein LSD1 from Arabidopsis with 66.31% of identity
• Blastx: Protein LSD1 from Arabidopsis with 65.1% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G20380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415966.1)
• Pfam: LSD1 zinc finger (PF06943.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;