| Transcript | Ll_transcript_297676 |
|---|---|
| CDS coordinates | 3-770 (+) |
| Peptide sequence | WLKICIQKGVQELDFNFFQRGYFLVPELLEIPTLKILKLSNVQFGVPPVTNGWQNLHTVILREMELHEEQLESVMLYGKMIECLDLGSCREIRRMSIFASEHKKFRTLKITTCPNLEKIEIDAPTLRNIHYCGFVIKLEFTQVVPSLSEAKFIFFRSRNYLQIPILQNLVNHLHNVRVLTTSAQFQEALSNRFRDGVFQGPQFYFSNIKELHIVMDGANFCNPYDIIVFLKNCPSLQTLFIDLNDYHFECGTYWEM |
| ORF Type | internal |
| Blastp | FBD-associated F-box protein At1g61320 from Arabidopsis with 32.06% of identity |
|---|---|
| Blastx | FBD-associated F-box protein At1g61320 from Arabidopsis with 32.06% of identity |
| Eggnog | - F-box, LRR and FBD domain containing protein, expressed(ENOG4111C2X) |
| Kegg | Link to kegg annotations (AT1G61320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438915.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer