Protein coding transcript 170305

• Transcript: Ll_transcript_124281
• CDS coordinates: 277-618 (+)
• Peptide sequence: MRLSVLAGYILWDAANTGHPVLNILQVEQMRNAGLIKGGSLENAIVCSTSKGWLNPPLHFSDEPCRHKVLDLIGDLSLSAQFGNQGLPVAHIVAYKGGHALHADLARRLMGMI*
• ORF Type: complete

Annotations of Ll_transcript_124281

• Blastp: Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 5, mitochondrial from Arabidopsis with 76.19% of identity
• Blastx: Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 5, mitochondrial from Arabidopsis with 76.19% of identity
• Eggnog: involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell (By similarity)(COG0774)
• Kegg: Link to kegg annotations (AT1G24793)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422372.1)
• Pfam: UDP-3-O-acyl N-acetylglycosamine deacetylase (PF03331.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;