Transcript | Ll_transcript_122549 |
---|---|
CDS coordinates | 2-481 (+) |
Peptide sequence | TDCFNCLPVAALVDDKILCMHGGLSPELAHLDEIRNLPRPIAIPDTGLLCDLLWSDPGRDVKGWGMNDRGVSFTFGPDKVAEFLAKHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDENLMCSFQILKPAEKKSKFMMPNKM* |
ORF Type | 5prime_partial |
Blastp | Serine/threonine-protein phosphatase PP1 isozyme 4 from Arabidopsis with 90.57% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase PP1 isozyme 4 from Arabidopsis with 90.57% of identity |
Eggnog | serine threonine-protein phosphatase(COG0639) |
Kegg | Link to kegg annotations (AT2G39840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433211.1) |
Pfam | Calcineurin-like phosphoesterase (PF00149.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer