Protein coding transcript 170409

• Transcript: Ll_transcript_123014
• CDS coordinates: 149-499 (-)
• Peptide sequence: MVTISFFLCHANEQIDKLSDLCTYILVLYCLNSWFCIVEHKGCDASVLLDSVEGMQSEKEAGPNLNSLRGFEVIDKIKYLLEEECPVTVSCADILAMAARDAVELVQYTPMFFPST*
• ORF Type: complete

Annotations of Ll_transcript_123014

• Blastp: Peroxidase 20 from Arabidopsis with 78.12% of identity
• Blastx: Peroxidase 20 from Arabidopsis with 53.42% of identity
• Eggnog: peroxidase(ENOG410YDW3)
• Kegg: Link to kegg annotations (AT2G35380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421098.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;