Protein coding transcript 170430

• Transcript: Ll_transcript_121739
• CDS coordinates: 91-396 (+)
• Peptide sequence: MGRGKIVIRRIDNSTSRQVTFSKRRSGLLKKAKELAILCDAEVGVVIFSSTGKLHEFSNTSMKSVIDRYNKTKEEHHPFGNSTSEVKVFINILYLCPKIVC*
• ORF Type: complete

Annotations of Ll_transcript_121739

• Blastp: MADS-box transcription factor ANR1 from Arabidopsis with 76.67% of identity
• Blastx: MADS-box transcription factor ANR1 from Arabidopsis with 76.67% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G14210)
• CantataDB: Link to cantataDB annotations (CNT0001842)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415009.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;