Protein coding transcript 1705

• Transcript: Ll_transcript_297596
• CDS coordinates: 3-386 (+)
• Peptide sequence: HRQFYRSCVIAGTIDFIFGDAASVFQNCIMQVRKPMANQQNIVTAQGRYQKQETTGFVLQKCEIKADNTLVSEKDKIKSYLGRPWKEYSRTIVMESEIGDIIHPDGWLPWAGDFALNTLYYAEFNNTG
• ORF Type: internal

Annotations of Ll_transcript_297596

• Blastp: Putative pectinesterase/pectinesterase inhibitor 28 from Arabidopsis with 59.38% of identity
• Blastx: Putative pectinesterase/pectinesterase inhibitor 28 from Arabidopsis with 59.38% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G27870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437550.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;