Protein coding transcript 170520

• Transcript: Ll_transcript_122045
• CDS coordinates: 680-1261 (+)
• Peptide sequence: MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSCMMKTLEKYQKYSYSALETTRSIIDTQTNYQEYVRLKAKVEVLQRSQRNLLGEDLAQMNTSELEQLENQLEAALMNIRSTKTQFMLGQLADLHNRVWNIFFCLLVDSKIFLSFNLIQPILYRKQCLLKLITR*
• ORF Type: complete

Annotations of Ll_transcript_122045

• Blastp: MADS-box protein EJ2 from Lycopersicon with 77.56% of identity
• Blastx: MADS-box protein CMB1 from Dianthus with 73.08% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (543884)
• CantataDB: Link to cantataDB annotations (CNT0002508)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462720.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;