Protein coding transcript 170524

• Transcript: Ll_transcript_122050
• CDS coordinates: 433-753 (+)
• Peptide sequence: MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSWDGMFDVQFCFTSRCNLRMMATRERKGRSVVLWLIIIKLQMNTDP*
• ORF Type: complete

Annotations of Ll_transcript_122050

• Blastp: MADS-box protein CMB1 from Dianthus with 98.36% of identity
• Blastx: MADS-box protein CMB1 from Dianthus with 98.36% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002508)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438979.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;