Protein coding transcript 170606

• Transcript: Ll_transcript_124416
• CDS coordinates: 256-645 (+)
• Peptide sequence: MASRVALVLFMCVLPAMVAAIRPEKNPFSVKGRVFCDPCRATFETSATTYIAGAEVIVQCKDRVTNEVVYTKKGITDSTGTYTIEVNEDHKDQVCDAKLVSSNHLTCNEDHKDQVCDAKLVSSNHLTCNE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_124416

• Blastp: Pollen-specific protein C13 from Zea with 42.31% of identity
• Blastx: Pollen-specific protein C13 from Zea with 42.31% of identity
• Eggnog: Pollen-specific protein(ENOG410YRT5)
• Kegg: Link to kegg annotations (542292)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438539.1)
• Pfam: Pollen proteins Ole e I like (PF01190.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;