| Transcript | Ll_transcript_123960 |
|---|---|
| CDS coordinates | 2-334 (+) |
| Peptide sequence | ESKLSQLKNAMQRLEEKFSDIESANLVLQKQSQLNSSVAEETCVTPVKKFGIESDAILRRSFIERQLENVDSLVKCVRKNIGFHNGKPVAAFTIYKCLLHLKSFEAEKTSV |
| ORF Type | internal |
| Blastp | Myosin-8 from Arabidopsis with 48.82% of identity |
|---|---|
| Blastx | Myosin-8 from Arabidopsis with 48.82% of identity |
| Eggnog | myosin heavy chain(COG5022) |
| Kegg | Link to kegg annotations (AT1G04160) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455075.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer