| Transcript | Ll_transcript_122078 |
|---|---|
| CDS coordinates | 392-691 (+) |
| Peptide sequence | MQDAKICFCDDTLPDGYSVNKGDMVSYQPYAMGRMKFIWGDDAEEYRPERWLDENGIFQQQSPFKFTAFQVSRVLLRTFDMYAYYRIFLTTVLVKESLY* |
| ORF Type | complete |
| Blastp | Cytochrome P450 704C1 from Pinus with 59.42% of identity |
|---|---|
| Blastx | Cytochrome P450 704C1 from Pinus with 60.29% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433532.1) |
| Pfam | Cytochrome P450 (PF00067.21) |
| Rfam | 5S_rRNA (RF00001) |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer