Protein coding transcript 170804

• Transcript: Ll_transcript_122403
• CDS coordinates: 126-512 (+)
• Peptide sequence: MSQPRFSFLCVLLYTLFIVCNGLSYMDLNLMKHSEVNNVMTKRVCTKSIGECLRLTEADMDMMDSESNRRMLAMQKKYISYETLKRDMVPCDRAGASYYNCHAKPANPYNRGCEVITGCARGVQPIKT*
• ORF Type: complete

Annotations of Ll_transcript_122403

• Blastp: Protein RALF-like 31 from Arabidopsis with 57.14% of identity
• Blastx: Protein RALF-like 31 from Arabidopsis with 57.14% of identity
• Eggnog: Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2 ) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases (By similarity)(ENOG41118KM)
• Kegg: Link to kegg annotations (AT4G13950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416599.1)
• Pfam: Rapid ALkalinization Factor (RALF) (PF05498.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;