Transcript | Ll_transcript_122411 |
---|---|
CDS coordinates | 1044-1367 (+) |
Peptide sequence | MVINMKYIDPTYMIRAIPSNASDNIYCTLLAHSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTEKTNTVKLTDRMWGRLLASTNQPSFISSDKEIILDLNDINITST* |
ORF Type | complete |
Blastp | ATP-dependent 6-phosphofructokinase 4, chloroplastic from Arabidopsis with 86.96% of identity |
---|---|
Blastx | ATP-dependent 6-phosphofructokinase 4, chloroplastic from Arabidopsis with 84.16% of identity |
Eggnog | phosphohexokinase(COG0205) |
Kegg | Link to kegg annotations (AT5G61580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427898.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer