Protein coding transcript 170809

• Transcript: Ll_transcript_122385
• CDS coordinates: 1196-1681 (+)
• Peptide sequence: MKEIAKRGLHVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFIEQRLKENGHLVIVVAEGAGQEYVAADVHAADKKDASGNKLLLDNGIWLSDKIKIQHT*
• ORF Type: complete

Annotations of Ll_transcript_122385

• Blastp: ATP-dependent 6-phosphofructokinase 4, chloroplastic from Arabidopsis with 80.62% of identity
• Blastx: ATP-dependent 6-phosphofructokinase 4, chloroplastic from Arabidopsis with 66.83% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (AT5G61580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427900.1)
• Pfam: Phosphofructokinase (PF00365.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;