Protein coding transcript 170813

• Transcript: Ll_transcript_122397
• CDS coordinates: 299-1009 (+)
• Peptide sequence: MDLSLSSLTFSYSLSKTLPPFSFSPFSRLLFLHPSPHSTTFLSFSRQNGRAITASQASNQSKNDDFVLEDVPHLTNFLPNLPSFPNPLQKSQAYSIVKKTFVSPEDVVTQNIVIQKDSPRGVHFRRAGPREKVYFKPEEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVEDILGIEGGYRGFYSKNTMKLTPKVVNDIHKRGGTFLRTSRGGHDTHKIVDNIEDRGINQVVTCF*
• ORF Type: complete

Annotations of Ll_transcript_122397

• Blastp: ATP-dependent 6-phosphofructokinase 4, chloroplastic from Arabidopsis with 83.14% of identity
• Blastx: ATP-dependent 6-phosphofructokinase 4, chloroplastic from Arabidopsis with 69.06% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (AT5G61580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427900.1)
• Pfam: Phosphofructokinase (PF00365.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;