Protein coding transcript 170817

• Transcript: Ll_transcript_121913
• CDS coordinates: 3-1268 (+)
• Peptide sequence: KSYTKTVITNSKHTTLVNLNLRLSNIKLEANCYEGCSIHFFIIVDIGKMVSIAVLLLCLSIPLLLLLFFQKPRSIKYPCPPPGPRGLPIIGNLHQLNNSSTLHVQLWQLSKKYGPLFSLQLGLRPAIVVSSPKLAKEVLKNQGLVFSGRPSLYGQQKLSYNGSEIVFSPYSDYWREMRKVCVVNIFSSKRVSSFSSIRHYEVKQMMKKISSHASSSTVTNLSELLISLSSNIICRIAFGRKYEDEGTEKSRFHEMLNEVQAMLGTIFVSDYIPFMGWIDKLIGLHARLDRIYKEMDKFFQQVIDEHMDQNREHAHDEDIVDVLLQLKMKHSFSNDLTYDHIKGVLLDILVAATDTTAATSVWAMTTLIKKPSIMKKAQEEIRKIGGKKDFLEENDIQNLPYLKAVIKETLRLYLPAPLLVPR
• ORF Type: internal

Annotations of Ll_transcript_121913

• Blastp: Cytochrome P450 83B1 from Arabidopsis with 47.97% of identity
• Blastx: Cytochrome P450 83B1 from Arabidopsis with 48.94% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT4G31500)
• CantataDB: Link to cantataDB annotations (CNT0001517)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447088.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;