Transcript | Ll_transcript_124049 |
---|---|
CDS coordinates | 378-1070 (+) |
Peptide sequence | MNYLRPDIKRGNISPEEDDLIIRMHSLLGNRWSLIAGRIPGRTDNEIKNYWNTHLCKKMKNQGTDLEEESPSASKKKTKKNKQRKEKKKNKETSEDEETEKKTKVYLPKPIRVKPLTLPRTDSSFTFDSSASSSQGNNSNSKVESPEGTEDVMNLVCEVGMGENNGFGFFCEDHDIVNESNMLECETYFPMDHGQGTLEKLYEEYFQLLSVEDTCQYELDLDSFAESFLV* |
ORF Type | complete |
Blastp | Transcription repressor MYB5 from Arabidopsis with 71.83% of identity |
---|---|
Blastx | Transcription repressor MYB4 from Arabidopsis with 78.48% of identity |
Eggnog | Myblike DNAbinding domain containing protein(COG5147) |
Kegg | Link to kegg annotations (AT3G13540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459362.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer