Protein coding transcript 1709

• Transcript: Ll_transcript_511068
• CDS coordinates: 2-442 (+)
• Peptide sequence: EPSFHCTVLVSIDSSLYTNFKMLLQIRGQSSHALECEENETISSVKARAAALEMIPPQLISLYSAGSPLNDDLTVSQLENFNLELTVPLLGGKVHGSLARAGKVKGQTPKVEKQEKRRKKTGRAKRRFQYNRRFFNNVPTFGRRKGP
• ORF Type: internal

Annotations of Ll_transcript_511068

• Blastp: 40S ribosomal protein S30 from Oryzias with 72.22% of identity
• Blastx: 40S ribosomal protein S30 from Oryzias with 72.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003608708.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;