Transcript | Ll_transcript_356935 |
---|---|
CDS coordinates | 1449-1952 (+) |
Peptide sequence | MLPNLLAKHPQLKPYHFNPPGVLHPITVFYELSFGETEMKQVEVRKSLHSRLGLPYDRPLLRIANALDFSKLRNSGNASLQKGPSLPRDVHIGIPSSGVTGGTVSLVQGSYEYFHYLQDGYNDSGWGCAYRSLQTIISWFRLQNYSSIEVPSHRYLQFTSSNDGYCF* |
ORF Type | complete |
Blastp | Probable Ufm1-specific protease from Arabidopsis with 71.7% of identity |
---|---|
Blastx | Probable Ufm1-specific protease from Arabidopsis with 55.06% of identity |
Eggnog | ufm1-specific peptidase(ENOG410XTJE) |
Kegg | Link to kegg annotations (AT3G48380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414884.1) |
Pfam | Peptidase family C78 (PF07910.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer