Protein coding transcript 170940

• Transcript: Ll_transcript_123468
• CDS coordinates: 622-1194 (+)
• Peptide sequence: MLEVEALDSRTSILNQIMQTLMDPHVCKVGLWGMGDVGKSTLVKELAWKAVKDCSFGIVVSVELTEYPDVKTIQVKIAESLGMKKFDVETLDGRASRLRERICKEESILIIMDNIWERLDLIEVGVPFGDDHKGCKLLFSSRNLNISTQEMNVEERFCFKLEVLSEKESWSLFEKQVGNVVKITTYGLLH*
• ORF Type: complete

Annotations of Ll_transcript_123468

• Blastp: Probable disease resistance protein At4g27220 from Arabidopsis with 35.4% of identity
• Blastx: Probable disease resistance protein At4g27220 from Arabidopsis with 35.4% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G27220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425392.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;