Protein coding transcript 17096

• Transcript: Ll_transcript_356332
• CDS coordinates: 139-519 (+)
• Peptide sequence: MGSNEIESSGAEVVTVDVSITKGLIQNGHVYLDVRTKEEFEKGHVDAEKIINIPYMFNTPEGRVKNSEFMKEVLSATNKEDHLIVGCQSGVRSLYASADLLAEGFKDVRNMGGGYLDWVKNQFPVK*
• ORF Type: complete

Annotations of Ll_transcript_356332

• Blastp: Thiosulfate sulfurtransferase 18 from Arabidopsis with 59.2% of identity
• Blastx: Thiosulfate sulfurtransferase 18 from Arabidopsis with 59.2% of identity
• Eggnog: Rhodanese domain protein(COG0607)
• Kegg: Link to kegg annotations (AT5G66170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446894.1)
• Pfam: Rhodanese-like domain (PF00581.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;