Transcript | Ll_transcript_121749 |
---|---|
CDS coordinates | 2-436 (+) |
Peptide sequence | IMRETLIYLSHLDHDDTEKQMLRKLSKQLSGEDWTWNTLNTLCWAIGSISGSMMEEQENRFLVMVIRDLLNLCEITKGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHPGVQAVLYILIHQLCLCQTIQS* |
ORF Type | 5prime_partial |
Blastp | Protein EXPORTIN 1A from Arabidopsis with 95.24% of identity |
---|---|
Blastx | Protein EXPORTIN 1A from Arabidopsis with 95.24% of identity |
Eggnog | exportin(COG5101) |
Kegg | Link to kegg annotations (AT5G17020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014619902.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer