Protein coding transcript 171003

• Transcript: Ll_transcript_124347
• CDS coordinates: 347-1390 (+)
• Peptide sequence: MGLSSLHVCMDSSDHWLQGTIHEESGMDSSSPSGDMLTCSRPMIERRLRPPHDQALNCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVSTKKSNDQLPNNNYQNQPQPQGSNSYHHNPKDLQLSFPDVQFSQLSNFLGTNAAGTLGNPDFMENRYNNINGIFNNPTRPIDFIESKVEGIIGSSSSSRNYDFFGNSDHMGMAVGLRGEYHMNGQNGLLLPSNFHSLYSPASFGAMSLDGGGNNNNRGYIMDHSCHRLMLPYDHVTNEGHNDSLDVKPNPKQLLSLEWQDQGCSDAGKDSFGYLNGPGSWNGMMNGYGSSTTNPLV*
• ORF Type: complete

Annotations of Ll_transcript_124347

• Blastp: Dof zinc finger protein DOF5.6 from Arabidopsis with 40.8% of identity
• Blastx: Dof zinc finger protein DOF5.6 from Arabidopsis with 39% of identity
• Eggnog: Zinc finger protein(ENOG410YEQW)
• Kegg: Link to kegg annotations (AT5G62940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414289.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;