Protein coding transcript 171200

• Transcript: Ll_transcript_122844
• CDS coordinates: 143-631 (+)
• Peptide sequence: MVHLRQRNTYTGNSLTPWLKPQVSFNDHDNLPGMLDSSLPQELGSTVNEIIKGSRLSANAMVDAAFQALSSTKEDEDAFMRIGQALDSIDYQQLASNTRLPLIRSHEQVNGSSYHHNQSTGCVSVPLLNDASDPKLHNDSKKGYTEIPLELITSCVATLIMIQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_122844

• Blastp: Protein ALWAYS EARLY 2 from Arabidopsis with 42.74% of identity
• Blastx: Protein ALWAYS EARLY 2 from Arabidopsis with 42.74% of identity
• Eggnog: lin-9 homolog (C. elegans)(ENOG410YA1T)
• Kegg: Link to kegg annotations (AT3G05380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441177.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;