| Transcript | Ll_transcript_122846 |
|---|---|
| CDS coordinates | 184-486 (+) |
| Peptide sequence | MAPAKKSRSVSKRFSASNEVSPENDGVNSIKNKLRKKKLTDKLGSQWSKEELEQFYQAYRKYDKDWKKVCFSHAVMSFSSSSFFIWKFDGNYSRSFFLSIL |
| ORF Type | 3prime_partial |
| Blastp | Protein ALWAYS EARLY 1 from Arabidopsis with 60% of identity |
|---|---|
| Blastx | Protein ALWAYS EARLY 1 from Arabidopsis with 60% of identity |
| Eggnog | lin-9 homolog (C. elegans)(ENOG410YA1T) |
| Kegg | Link to kegg annotations (AT5G27610) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441177.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer