Transcript | Ll_transcript_123265 |
---|---|
CDS coordinates | 1152-2102 (+) |
Peptide sequence | MSVAASLVQGAYILERDRQEKREGPNALAPPWWKFFHFQLLRPLLDDVDSSIFGAIYEFKPPPSQNNDTLDRSPRYVIAFRGTLTKSDSVSRDIALDIHLIRQGLHQTSRSDIAIRAVRNMVATVGDSNVWLAGHSLGSAMAMLTGKTLAKSGNFIESFLFNPPFVSAPIERIKDEKVKHGIRFAGSVITAGLTIAMHAKQPKDLSVDPFAALAVWVPCLFVNPCDHICSEYIGYFEHRRKMDEIGAGVIERLATQNSLGGLLMSAFGKESEPLHLIPSAYLTVNIGPTHDFKDAHGIHQWWKPHLHLEHKLYKYK* |
ORF Type | complete |
Blastp | GDSL esterase/lipase At4g10955 from Arabidopsis with 61.54% of identity |
---|---|
Blastx | GDSL esterase/lipase At4g10955 from Arabidopsis with 62.26% of identity |
Eggnog | GDSL esterase lipase(ENOG410YP6W) |
Kegg | Link to kegg annotations (AT4G10955) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446506.1) |
Pfam | Lipase (class 3) (PF01764.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer