Protein coding transcript 171270

• Transcript: Ll_transcript_123691
• CDS coordinates: 431-796 (+)
• Peptide sequence: MFEPFIEDEVPFDEYCRSMETGGTWAGHMELQAASLVTHSNICIHRSMTPRWYIRNFDDRGARMIHLSYHDGEHYNSVRLKDDPCDGPAKSIVIKRHHIKQKLQLTNPVSGLIKELVCQGP*
• ORF Type: complete

Annotations of Ll_transcript_123691

• Blastp: OTU domain-containing protein 3 from Mus with 39.77% of identity
• Blastx: OTU domain-containing protein 3 from Mus with 40.66% of identity
• Eggnog: OTU domain containing 3(ENOG4110S6T)
• Kegg: Link to kegg annotations (73162)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422192.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;