Protein coding transcript 171287

• Transcript: Ll_transcript_123718
• CDS coordinates: 431-1285 (+)
• Peptide sequence: MFEPFIEDEVPFDEYCRSMETGGTWAGHMELQAASLVTHSNICIHRSMTPRWYIRNFDDRGARMIHLSYHDGEHYNSVRLKDDPCDGPAKSIVIKADADLSATSHQAKVTANKSRERTDKGTCLPGSIKLVMAGSGCENTEKVEQILEQVNGNVDAAIEFLIAEQGREECSATSDFFPSQADADGHDENENLEHKEHTVEDSVNAKSNDRSTKTNNNSTLQPTDKIPRNKFCPCGSKKKYKACCGSVLGKQHAKLVMYASETPFLYSCVSRFKYSHDVSWIFVY*
• ORF Type: complete

Annotations of Ll_transcript_123718

• Blastp: OTU domain-containing protein 3 from Mus with 31.95% of identity
• Blastx: OTU domain-containing protein 3 from Mus with 32.56% of identity
• Eggnog: OTU domain containing 3(ENOG4110S6T)
• Kegg: Link to kegg annotations (73162)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422192.1)
• Pfam: SEC-C motif (PF02810.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;