Protein coding transcript 1713

• Transcript: Ll_transcript_297658
• CDS coordinates: 3-317 (+)
• Peptide sequence: KSYLRYTAKENVKQMTFDNSDELYKIKALTPDAELYLRIFTDDSQSLCRLSQKFGAHMDTAPELLALAKALGLNIAGVAFHVGSGASDPSAFLKAVTDARNVFDQ
• ORF Type: internal

Annotations of Ll_transcript_297658

• Blastp: Ornithine decarboxylase from Neurospora with 68.57% of identity
• Blastx: Ornithine decarboxylase from Neurospora with 68.57% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU01271)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014500859.1)
• Pfam: Pyridoxal-dependent decarboxylase, pyridoxal binding domain (PF02784.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;