Protein coding transcript 171320

• Transcript: Ll_transcript_124085
• CDS coordinates: 3-500 (-)
• Peptide sequence: EAQQDLHSRPSPAALGASAVRGAPIAGLGPSLPARPGPKKGASAATGLVLSSNYKPEKPQVVLSSENGPENKSQSPKLSLKPSSGSANIYNPRKGNHKELLSRSATVQHSEVVIRLRPLKLVYDHDIRLAEMPVNCSFRVLRELVTKRFPSSKSVLIKYKDKDGDL
• ORF Type: internal

Annotations of Ll_transcript_124085

• Blastp: Protein CLMP1 from Arabidopsis with 54.97% of identity
• Blastx: Protein CLMP1 from Arabidopsis with 52.94% of identity
• Eggnog: Unc-45 homolog(ENOG410XQNT)
• Kegg: Link to kegg annotations (AT1G62390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418421.1)
• Pfam: PB1 domain (PF00564.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;