Protein coding transcript 171399

• Transcript: Ll_transcript_124170
• CDS coordinates: 1-537 (+)
• Peptide sequence: GTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRSDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMR
• ORF Type: internal

Annotations of Ll_transcript_124170

• Blastp: Eukaryotic initiation factor 4A-3 from Oryza sativa with 97.77% of identity
• Blastx: Eukaryotic initiation factor 4A-3 from Oryza sativa with 97.77% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (4328286)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416838.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;