Protein coding transcript 171403

• Transcript: Ll_transcript_124184
• CDS coordinates: 3-512 (+)
• Peptide sequence: QQIEKVMRALGDYLGVRVHACVAGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRADYIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRK
• ORF Type: internal

Annotations of Ll_transcript_124184

• Blastp: Eukaryotic initiation factor 4A-1 from Oryza sativa with 96.47% of identity
• Blastx: Eukaryotic initiation factor 4A-1 from Oryza sativa with 96.47% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (4341966)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416838.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;