Protein coding transcript 171474

• Transcript: Ll_transcript_123086
• CDS coordinates: 1369-1812 (+)
• Peptide sequence: MDDILIAENLSEATAFNVQPLDSVQMMDLDVKTIRTEVVSNDMKLYTHDTEQDFPQKNAIVSRIRSTTAGRNYQIGRGSISTKRSSKAYNGGRLKNPIQKKVDAKFAAGLLASKEAQEEILKCEVCLSLVFSCAEHIITLAFNSVSK*
• ORF Type: complete

Annotations of Ll_transcript_123086

• Blastp: Histone-lysine N-methyltransferase ASHH1 from Arabidopsis with 42.15% of identity
• Blastx: Histone-lysine N-methyltransferase ASHH1 from Arabidopsis with 64.48% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT1G76710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427259.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;