Protein coding transcript 171475

• Transcript: Ll_transcript_123089
• CDS coordinates: 135-494 (+)
• Peptide sequence: MRNHHHRAFFLLLLTITTCLIIQTQSEVLTLTSDTLSDKIKEKDTAWFVKFCVPWCKHCKKLGSLWDELGKVMEKEDEIEIGEVDCGTDKAVCSKVDIHSYPTFKVFYDGEEVAKYQGN*
• ORF Type: complete

Annotations of Ll_transcript_123089

• Blastp: Protein disulfide-isomerase 5-1 from Arabidopsis with 68.75% of identity
• Blastx: Protein disulfide isomerase-like 5-1 from Oryza sativa with 76.77% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT1G07960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458821.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;