Transcript | Ll_transcript_123091 |
---|---|
CDS coordinates | 1400-1771 (+) |
Peptide sequence | MDDILIAENLSEATAFNVQPLDSVQMMDLDVKTIRTEVVSNDMKLYTHDTEQDFPQKNAIVSRIRSTTAGRNYQIGRGSISTKRSSKAYNGGRLKNPIQKKVDAKFAAGLLASKEAQEEILKCE |
ORF Type | 3prime_partial |
Blastp | Histone-lysine N-methyltransferase ASHH1 from Arabidopsis with 42.15% of identity |
---|---|
Blastx | Histone-lysine N-methyltransferase ASHH1 from Arabidopsis with 76.97% of identity |
Eggnog | Histone-lysine N-methyltransferase(COG2940) |
Kegg | Link to kegg annotations (AT1G76710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427259.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer