Protein coding transcript 171484

• Transcript: Ll_transcript_123082
• CDS coordinates: 222-923 (+)
• Peptide sequence: MDPHVEELPQYIHINQNDFLTRRHKKQKEEDIAICECKHNANDPDSACGDGCLNVLTSTECTPGYCPCGIVCKNQKFQKCEYAKTKLFKTEGRGWGLVADENIKAGQFVIEYCGEVISWKEAKRRSQAYETQGLKDAFIICLNASESIDATRKGSLGRFINHSCQPNCETRKWNVLGEIRVGIFAKHDIPIGAELAYDYNFEWFGGAKVRCLCGALKCSGFLGAKSRGFQVSF*
• ORF Type: complete

Annotations of Ll_transcript_123082

• Blastp: Histone-lysine N-methyltransferase ASHH1 from Arabidopsis with 79.65% of identity
• Blastx: Histone-lysine N-methyltransferase ASHH1 from Arabidopsis with 79.65% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT1G76710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427259.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;