Protein coding transcript 171570

• Transcript: Ll_transcript_124059
• CDS coordinates: 227-844 (+)
• Peptide sequence: MEASVKEELSEIPISNARERKERNGVVSSPPPGGLIELSSDSDSDSDVDVLGENSSKKRKTNDVGVVLPIGFLSPLPPATALPSSQAMLSLPAPNSVSALVRSDGIATFASQSNGCKQFWKAGDFDGPPASAFESSTIGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVCNGATYVNVDRVVSKKDGTRMLLIERIFIS*
• ORF Type: complete

Annotations of Ll_transcript_124059

• Blastp: Protein MICRORCHIDIA 4 from Arabidopsis with 45.81% of identity
• Blastx: Protein MICRORCHIDIA 4 from Arabidopsis with 60.53% of identity
• Eggnog: MORC family CW-type zinc finger(ENOG411033B)
• Kegg: Link to kegg annotations (AT5G50780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463397.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;