Protein coding transcript 17161

• Transcript: Ll_transcript_356127
• CDS coordinates: 2-496 (+)
• Peptide sequence: FDNSNGPPLYFSCPHSHDSFVIEKIELIFYFGSIIVTEKMKFGKSLSNQIEKTLPQWRDKFLSYKELKKKLKLVEPASKGSDEERSAKRVRVDGEKMLKEEIDFRKSLENEVYKFNTFFVEKEEECIIRFKVSFFIIYFVRVIYFGAMLISYEIWLNTKLLLEK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_356127

• Blastp: SPX domain-containing protein 2 from Arabidopsis with 56.88% of identity
• Blastx: SPX domain-containing protein 2 from Arabidopsis with 65.81% of identity
• Eggnog: Vacuolar transporter chaperone(COG5036)
• Kegg: Link to kegg annotations (AT2G26660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431296.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;